Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies) core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest |
Superfamily c.97.3: JAB1/MPN domain [102712] (2 families) |
Family c.97.3.1: JAB1/MPN domain [102713] (8 proteins) Pfam PF01398; Pfam PF14464; synonyms Mov34, PAD-1. PubMed 17559875 asserts homology to (c.97.1) |
Protein Catalytic domain of AMSH [267642] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [267701] (2 PDB entries) |
Domain d3rzuc_: 3rzu C: [265336] complexed with zn |
PDB Entry: 3rzu (more details), 2.5 Å
SCOPe Domain Sequences for d3rzuc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rzuc_ c.97.3.1 (C:) Catalytic domain of AMSH {Human (Homo sapiens) [TaxId: 9606]} iptidglrhvvvpgrlcpqflqlasantargvetcgilcgklmrneftithvlipkqsag sdycnteneeelfliqdqqglitlgwihthptqtaflssvdlhthcsyqmmlpesvaivc spkfqetgffkltdhgleeisscrqkgfhphskdpplfcscshvtvvdravtitdlr
Timeline for d3rzuc_: