Lineage for d3rzua_ (3rzu A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2918481Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
    core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest
  4. 2918897Superfamily c.97.3: JAB1/MPN domain [102712] (2 families) (S)
  5. 2918898Family c.97.3.1: JAB1/MPN domain [102713] (8 proteins)
    Pfam PF01398; Pfam PF14464; synonyms Mov34, PAD-1. PubMed 17559875 asserts homology to (c.97.1)
  6. 2918899Protein Catalytic domain of AMSH [267642] (1 species)
  7. 2918900Species Human (Homo sapiens) [TaxId:9606] [267701] (2 PDB entries)
  8. 2918902Domain d3rzua_: 3rzu A: [265334]
    complexed with zn

Details for d3rzua_

PDB Entry: 3rzu (more details), 2.5 Å

PDB Description: The Crystal Structure of the Catalytic Domain of AMSH
PDB Compounds: (A:) stam-binding protein

SCOPe Domain Sequences for d3rzua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rzua_ c.97.3.1 (A:) Catalytic domain of AMSH {Human (Homo sapiens) [TaxId: 9606]}
ptidglrhvvvpgrlcpqflqlasantargvetcgilcgklmrneftithvlipkqsags
dycnteneeelfliqdqqglitlgwihthptqtaflssvdlhthcsyqmmlpesvaivcs
pkfqetgffkltdhgleeisscrqkgfhphskdpplfcscshvtvvdravtitdlr

SCOPe Domain Coordinates for d3rzua_:

Click to download the PDB-style file with coordinates for d3rzua_.
(The format of our PDB-style files is described here.)

Timeline for d3rzua_: