Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) |
Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
Protein automated matches [226922] (95 species) not a true protein |
Species Chromohalobacter salexigens [TaxId:158080] [267864] (6 PDB entries) |
Domain d3rgtd1: 3rgt D:4-113 [265328] Other proteins in same PDB: d3rgta2, d3rgta3, d3rgtb2, d3rgtb3, d3rgtc2, d3rgtc3, d3rgtd2, d3rgtd3 automated match to d4il2a1 complexed with co, ez4 |
PDB Entry: 3rgt (more details), 1.9 Å
SCOPe Domain Sequences for d3rgtd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rgtd1 d.54.1.0 (D:4-113) automated matches {Chromohalobacter salexigens [TaxId: 158080]} kirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligrdag riedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllgg
Timeline for d3rgtd1: