Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
Family c.1.11.0: automated matches [227196] (1 protein) not a true family |
Protein automated matches [226923] (79 species) not a true protein |
Species Chromohalobacter salexigens [TaxId:158080] [267865] (6 PDB entries) |
Domain d3rgtc2: 3rgt C:114-405 [265327] Other proteins in same PDB: d3rgta1, d3rgta3, d3rgtb1, d3rgtb3, d3rgtc1, d3rgtc3, d3rgtd1, d3rgtd3 automated match to d4il2a2 complexed with co, ez4 |
PDB Entry: 3rgt (more details), 1.9 Å
SCOPe Domain Sequences for d3rgtc2:
Sequence, based on SEQRES records: (download)
>d3rgtc2 c.1.11.0 (C:114-405) automated matches {Chromohalobacter salexigens [TaxId: 158080]} ksrervmtyahctgqtiedclgevarhvelgyravrvqsgvpgiettygvaktpgeryep adsslpaehvwstekylnhapklfaavrerfgddlhvlhdvhhrltpieaarlgkavepy hlfwledcvpaenqeslrlirehtttplaigevfnsihdcreliqnqwidyirmplthgg gitamrrvadlaslyhvrtgfhgptdlspvclgaaihfdtwvpnfgiqehmphtdetdav fphdyrfedghflagespghgvdideelaakypyeraslpvnrledgtlwhw
>d3rgtc2 c.1.11.0 (C:114-405) automated matches {Chromohalobacter salexigens [TaxId: 158080]} ksrervmtyahctgqtiedclgevarhvelgyravrvqsgvpgislpaehvwstekylnh apklfaavrerfgddlhvlhdvhhrltpieaarlgkavepyhlfwledcvpaenqeslrl irehtttplaigevfnsihdcreliqnqwidyirmplthgggitamrrvadlaslyhvrt gfhgptdlspvclgaaihfdtwvpnfgiqehmphtdetdavfphdyrfedghflagespg hgvdideelaakypyeraslpvnrledgtlwhw
Timeline for d3rgtc2: