SCOPe 2.06: Domain d3rc6a1: 3rc6 A:986-1181

Lineage for d3rc6a1 (3rc6 A:986-1181)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.3: Viral proteases [50596] (5 proteins)
   beta sheet in the first domain is opened rather than forms a barrel

6. Protein NS3 protease [50600] (5 species)

7. Species Hepatitis c virus subtype 1a [TaxId:31646] [254867] (2 PDB entries)

8. Domain d3rc6a1: 3rc6 A:986-1181 [265317]
   Other proteins in same PDB: d3rc6a2
   automated match to d3sv6a_
   complexed with zn

Details for d3rc6a1

PDB Entry: 3rc6, 1.3 Å

PDB Description: molecular mechanisms of viral and host-cell substrate recognition by hcv ns3/4a protease

PDB Compounds: (A:) ns3/4a

SCOPe Domain Sequences for d3rc6a1:

Sequence; same for both SEQRES and ATOM records:

>d3rc6a1 b.47.1.3 (A:986-1181) NS3 protease {Hepatitis c virus subtype 1a [TaxId: 31646]}
mkkkgsvvivgrinlsgdtayaqqtrgeegcqetsqtgrdknqvegevqivstatqtfla
tsingvlwtvyhgagtrtiaspkgpvtqmytnvdkdlvgwqapqgsrsltpctcgssdly
lvtrhadvipvrrrgdsrgsllsprpisylkgsaggpllcpaghavgifraavstrgvak
avdfipveslettmrs

Timeline for d3rc6a1:

• d3rc6a1 first appeared in SCOPe 2.05, called d3rc6a_
  
• d3rc6a1 appears in SCOPe 2.07
  
• d3rc6a1 appears in the current release, SCOPe 2.08