![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.92: Chelatase-like [53799] (3 superfamilies) duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134 |
![]() | Superfamily c.92.2: 'Helical backbone' metal receptor [53807] (5 families) ![]() contains a long alpha helical insertion in the interdomain linker |
![]() | Family c.92.2.0: automated matches [191548] (1 protein) not a true family |
![]() | Protein automated matches [190944] (40 species) not a true protein |
![]() | Species Vibrio cholerae [TaxId:666] [193580] (3 PDB entries) |
![]() | Domain d3r5ta1: 3r5t A:31-325 [265313] Other proteins in same PDB: d3r5ta2 automated match to d2m6ka_ complexed with acy, edo, fe, moh, vbn |
PDB Entry: 3r5t (more details), 1.45 Å
SCOPe Domain Sequences for d3r5ta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3r5ta1 c.92.2.0 (A:31-325) automated matches {Vibrio cholerae [TaxId: 666]} nvwprtfqnadgsittipsqpkrilstavtvtgtllaidapviasaattqstffeqwrkl aelrqvkklwpagsvdlesvyveqpdlivvsmigadsardqipllqaiaptilvdysdqt wqslaqqlglatgleeqaertihnfeqwtkqvrdvldlpkgranivsyhgpgvvnavaka qsahaqllqsvgvvleepdpawqagsivhrdflrihyehltqlqaettflitmtdqqaqa flhdpilknlpsiqrkqvyglgensfridlfsareiinsllrrfageqaqslvmp
Timeline for d3r5ta1: