Lineage for d3r41a1 (3r41 A:1-300)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2901917Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2901918Protein automated matches [190543] (131 species)
    not a true protein
  7. 2902904Species Rhodopseudomonas palustris [TaxId:1076] [267879] (11 PDB entries)
  8. 2902907Domain d3r41a1: 3r41 A:1-300 [265310]
    Other proteins in same PDB: d3r41a2
    automated match to d3qyja_
    complexed with ca, cl

Details for d3r41a1

PDB Entry: 3r41 (more details), 1.05 Å

PDB Description: Crystal Structure of the Fluoroacetate Dehalogenase RPA1163 - His280Asn/apo
PDB Compounds: (A:) Fluoroacetate Dehalogenase

SCOPe Domain Sequences for d3r41a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3r41a1 c.69.1.0 (A:1-300) automated matches {Rhodopseudomonas palustris [TaxId: 1076]}
mpdladlfpgfgsewintssgrifarvggdgppllllhgfpqthvmwhrvapklaerfkv
ivadlpgygwsdmpesdeqhtpytkramakqlieameqlghvhfalaghdrgarvsyrla
ldspgrlsklavldilptyeywqrmnrayalkiyhwsflaqpaplpenllggdpdfyvka
klaswtragdlsafdpravehyriafadpmrrhvmcedyragayadfehdkidveagnki
pvpmlalwgasgiaqsaatpldvwrkwasdvqgapiesgnflpeeapdqtaealvrffsa

SCOPe Domain Coordinates for d3r41a1:

Click to download the PDB-style file with coordinates for d3r41a1.
(The format of our PDB-style files is described here.)

Timeline for d3r41a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3r41a2
View in 3D
Domains from other chains:
(mouse over for more information)
d3r41b_