SCOPe 2.05: Domain d3r3zd_: 3r3z D:

Lineage for d3r3zd_ (3r3z D:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (71 species)
   not a true protein

7. Species Rhodopseudomonas palustris [TaxId:1076] [267879] (8 PDB entries)

8. Domain d3r3zd_: 3r3z D: [265307]
   automated match to d3qyja_
   complexed with goa, ni

Details for d3r3zd_

PDB Entry: 3r3z, 1.7 Å

PDB Description: Crystal Structure of the Fluoroacetate Dehalogenase RPA1163 - WT/Glycolate

PDB Compounds: (D:) Fluoroacetate Dehalogenase

SCOPe Domain Sequences for d3r3zd_:

Sequence; same for both SEQRES and ATOM records:

>d3r3zd_ c.69.1.0 (D:) automated matches {Rhodopseudomonas palustris [TaxId: 1076]}
adlfpgfgsewintssgrifarvggdgppllllhgfpqthvmwhrvapklaerfkvivad
lpgygwsdmpesdeqhtpytkramakqlieameqlghvhfalaghdrgarvsyrlaldsp
grlsklavldilptyeywqrmnrayalkiyhwsflaqpaplpenllggdpdfyvkaklas
wtragdlsafdpravehyriafadpmrrhvmcedyragayadfehdkidveagnkipvpm
lalwgasgiaqsaatpldvwrkwasdvqgapiesghflpeeapdqtaealvrffsa

Timeline for d3r3zd_:

• d3r3zd_ is new in SCOPe 2.05-stable
  
• d3r3zd_ appears in SCOPe 2.06
  
• d3r3zd_ appears in the current release, SCOPe 2.08