Lineage for d3r3zc1 (3r3z C:1-299)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2901917Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2901918Protein automated matches [190543] (131 species)
    not a true protein
  7. 2902904Species Rhodopseudomonas palustris [TaxId:1076] [267879] (11 PDB entries)
  8. 2902919Domain d3r3zc1: 3r3z C:1-299 [265306]
    Other proteins in same PDB: d3r3za2, d3r3zb2, d3r3zc2
    automated match to d3qyja_
    complexed with goa, ni

Details for d3r3zc1

PDB Entry: 3r3z (more details), 1.7 Å

PDB Description: Crystal Structure of the Fluoroacetate Dehalogenase RPA1163 - WT/Glycolate
PDB Compounds: (C:) Fluoroacetate Dehalogenase

SCOPe Domain Sequences for d3r3zc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3r3zc1 c.69.1.0 (C:1-299) automated matches {Rhodopseudomonas palustris [TaxId: 1076]}
mpdladlfpgfgsewintssgrifarvggdgppllllhgfpqthvmwhrvapklaerfkv
ivadlpgygwsdmpesdeqhtpytkramakqlieameqlghvhfalaghdrgarvsyrla
ldspgrlsklavldilptyeywqrmnrayalkiyhwsflaqpaplpenllggdpdfyvka
klaswtragdlsafdpravehyriafadpmrrhvmcedyragayadfehdkidveagnki
pvpmlalwgasgiaqsaatpldvwrkwasdvqgapiesghflpeeapdqtaealvrffs

SCOPe Domain Coordinates for d3r3zc1:

Click to download the PDB-style file with coordinates for d3r3zc1.
(The format of our PDB-style files is described here.)

Timeline for d3r3zc1: