![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
![]() | Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) ![]() many members have left-handed crossover connection between strand 8 and additional strand 9 |
![]() | Family c.69.1.0: automated matches [191404] (1 protein) not a true family |
![]() | Protein automated matches [190543] (131 species) not a true protein |
![]() | Species Rhodopseudomonas palustris [TaxId:1076] [267879] (11 PDB entries) |
![]() | Domain d3r3zc1: 3r3z C:1-299 [265306] Other proteins in same PDB: d3r3za2, d3r3zb2, d3r3zc2 automated match to d3qyja_ complexed with goa, ni |
PDB Entry: 3r3z (more details), 1.7 Å
SCOPe Domain Sequences for d3r3zc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3r3zc1 c.69.1.0 (C:1-299) automated matches {Rhodopseudomonas palustris [TaxId: 1076]} mpdladlfpgfgsewintssgrifarvggdgppllllhgfpqthvmwhrvapklaerfkv ivadlpgygwsdmpesdeqhtpytkramakqlieameqlghvhfalaghdrgarvsyrla ldspgrlsklavldilptyeywqrmnrayalkiyhwsflaqpaplpenllggdpdfyvka klaswtragdlsafdpravehyriafadpmrrhvmcedyragayadfehdkidveagnki pvpmlalwgasgiaqsaatpldvwrkwasdvqgapiesghflpeeapdqtaealvrffs
Timeline for d3r3zc1: