Lineage for d3r3za_ (3r3z A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1869037Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 1869038Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 1871035Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 1871036Protein automated matches [190543] (71 species)
    not a true protein
  7. 1871570Species Rhodopseudomonas palustris [TaxId:1076] [267879] (8 PDB entries)
  8. 1871585Domain d3r3za_: 3r3z A: [265304]
    automated match to d3qyja_
    complexed with goa, ni

Details for d3r3za_

PDB Entry: 3r3z (more details), 1.7 Å

PDB Description: Crystal Structure of the Fluoroacetate Dehalogenase RPA1163 - WT/Glycolate
PDB Compounds: (A:) Fluoroacetate Dehalogenase

SCOPe Domain Sequences for d3r3za_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3r3za_ c.69.1.0 (A:) automated matches {Rhodopseudomonas palustris [TaxId: 1076]}
ghmpdladlfpgfgsewintssgrifarvggdgppllllhgfpqthvmwhrvapklaerf
kvivadlpgygwsdmpesdeqhtpytkramakqlieameqlghvhfalaghdrgarvsyr
laldspgrlsklavldilptyeywqrmnrayalkiyhwsflaqpaplpenllggdpdfyv
kaklaswtragdlsafdpravehyriafadpmrrhvmcedyragayadfehdkidveagn
kipvpmlalwgasgiaqsaatpldvwrkwasdvqgapiesghflpeeapdqtaealvrff
saap

SCOPe Domain Coordinates for d3r3za_:

Click to download the PDB-style file with coordinates for d3r3za_.
(The format of our PDB-style files is described here.)

Timeline for d3r3za_: