Lineage for d3r3xb_ (3r3x B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2134062Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2134063Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2136079Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2136080Protein automated matches [190543] (90 species)
    not a true protein
  7. 2136616Species Rhodopseudomonas palustris [TaxId:1076] [267879] (9 PDB entries)
  8. 2136636Domain d3r3xb_: 3r3x B: [265301]
    automated match to d3qyja_
    complexed with bxa, ca, cl

Details for d3r3xb_

PDB Entry: 3r3x (more details), 1.8 Å

PDB Description: Crystal Structure of the Fluoroacetate Dehalogenase RPA1163 - Asp110Asn/Bromoacetate
PDB Compounds: (B:) Fluoroacetate Dehalogenase

SCOPe Domain Sequences for d3r3xb_:

Sequence, based on SEQRES records: (download)

>d3r3xb_ c.69.1.0 (B:) automated matches {Rhodopseudomonas palustris [TaxId: 1076]}
ladlfpgfgsewintssgrifarvggdgppllllhgfpqthvmwhrvapklaerfkviva
dlpgygwsdmpesdeqhtpytkramakqlieameqlghvhfalaghnrgarvsyrlalds
pgrlsklavldilptyeywqrmnrayalkiyhwsflaqpaplpenllggdpdfyvkakla
swtragdlsafdpravehyriafadpmrrhvmcedyragayadfehdkidveagnkipvp
mlalwgasgiaqsaatpldvwrkwasdvqgapiesghflpeeapdqtaealvrffsa

Sequence, based on observed residues (ATOM records): (download)

>d3r3xb_ c.69.1.0 (B:) automated matches {Rhodopseudomonas palustris [TaxId: 1076]}
ladlfpgfgsewintssgrifarvggdgppllllhgfpqthvmwhrvapklaerfkviva
dlpgygwsdmpesdeqhtpytkramakqlieameqlghvhfalaghnrgarvsyrlalds
pgrlsklavldilptyeywqrmnrayalkiyhwsflaqpaplpenllggdpdfyvkakla
swtragdlsafdpravehyriafadpmrrhvmcedyragayadfehdkidveagnkipvp
mlalwgaspldvwrkwasdvqgapiesghflpeeapdqtaealvrffsa

SCOPe Domain Coordinates for d3r3xb_:

Click to download the PDB-style file with coordinates for d3r3xb_.
(The format of our PDB-style files is described here.)

Timeline for d3r3xb_: