Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
Family c.1.11.2: D-glucarate dehydratase-like [51609] (15 proteins) |
Protein automated matches [226997] (11 species) not a true protein |
Species Vibrionales bacterium [TaxId:391574] [267878] (2 PDB entries) |
Domain d3r25h2: 3r25 H:118-401 [265291] Other proteins in same PDB: d3r25a1, d3r25b1, d3r25c1, d3r25d1, d3r25e1, d3r25f1, d3r25g1, d3r25h1 automated match to d3gy1a2 complexed with gol, mg |
PDB Entry: 3r25 (more details), 1.6 Å
SCOPe Domain Sequences for d3r25h2:
Sequence, based on SEQRES records: (download)
>d3r25h2 c.1.11.2 (H:118-401) automated matches {Vibrionales bacterium [TaxId: 391574]} ksrdaipvythatsdtmegiydlvegflekgykhircqlgfyggvptdlhttqnptegsy ydqdqymdntltmfkslrekygnqfhilhdvherlfpnqaiqfakeveqykpyfiedilp pnqtewldnirsqssvslglgelfnnpeewkslianrridfirchvsqiggitpalklgh lcqnfgvriawhcppdmtpigaavnthlnvhlhnaaiqehveyngnthkvfpnaaeping ylyaseiagigveidreaaaefpvmyrphewtqsrlpdgaihtp
>d3r25h2 c.1.11.2 (H:118-401) automated matches {Vibrionales bacterium [TaxId: 391574]} ksrdaipvythatsdtmegiydlvegflekgykhircqlgfygglhttqnptegsyydqd qymdntltmfkslrekygnqfhilhdvherlfpnqaiqfakeveqykpyfiedilppnqt ewldnirsqssvslglgelfnnpeewkslianrridfirchvsqiggitpalklghlcqn fgvriawhcppdmtpigaavnthlnvhlhnaaiqehveyngnthkvfpnaaepingylya seiagigveidreaaaefpvmyrphewtqsrlpdgaihtp
Timeline for d3r25h2: