Lineage for d3r25h1 (3r25 H:4-117)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2554471Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2554472Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2554768Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2554769Protein automated matches [226922] (94 species)
    not a true protein
  7. 2555567Species Vibrionales bacterium [TaxId:391574] [267877] (3 PDB entries)
  8. 2555579Domain d3r25h1: 3r25 H:4-117 [265290]
    Other proteins in same PDB: d3r25a2, d3r25a3, d3r25b2, d3r25b3, d3r25c2, d3r25c3, d3r25d2, d3r25d3, d3r25e2, d3r25e3, d3r25f2, d3r25f3, d3r25g2, d3r25g3, d3r25h2, d3r25h3
    automated match to d3gy1a1
    complexed with gol, mg

Details for d3r25h1

PDB Entry: 3r25 (more details), 1.6 Å

PDB Description: Crystal structure of enolase superfamily member from Vibrionales bacterium complexed with Mg and Glycerol in the active site
PDB Compounds: (H:) Mandelate racemase / muconate lactonizing enzyme

SCOPe Domain Sequences for d3r25h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3r25h1 d.54.1.0 (H:4-117) automated matches {Vibrionales bacterium [TaxId: 391574]}
ketiisdihciitkpdrhnlitvvvetnegvtgfgcatfqqrplavktmvdeylkpilig
knanniedlwqmmmvnaywrngpvinnaisgvdmalwdikaklagmplhqlfgg

SCOPe Domain Coordinates for d3r25h1:

Click to download the PDB-style file with coordinates for d3r25h1.
(The format of our PDB-style files is described here.)

Timeline for d3r25h1: