| Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
| Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) ![]() |
| Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
| Protein automated matches [226922] (83 species) not a true protein |
| Species Vibrionales bacterium [TaxId:391574] [267877] (2 PDB entries) |
| Domain d3r25h1: 3r25 H:3-117 [265290] Other proteins in same PDB: d3r25a2, d3r25b2, d3r25c2, d3r25d2, d3r25e2, d3r25f2, d3r25g2, d3r25h2 automated match to d3gy1a1 complexed with gol, mg |
PDB Entry: 3r25 (more details), 1.6 Å
SCOPe Domain Sequences for d3r25h1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3r25h1 d.54.1.0 (H:3-117) automated matches {Vibrionales bacterium [TaxId: 391574]}
lketiisdihciitkpdrhnlitvvvetnegvtgfgcatfqqrplavktmvdeylkpili
gknanniedlwqmmmvnaywrngpvinnaisgvdmalwdikaklagmplhqlfgg
Timeline for d3r25h1: