SCOP 1.55: Domain d2aida_: 2aid A:

Lineage for d2aida_ (2aid A:)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)

4. Superfamily b.50.1: Acid proteases [50630] (2 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (7 proteins)

6. Protein Human immunodeficiency virus type 1 protease [50632] (1 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (108 PDB entries)

8. Domain d2aida_: 2aid A: [26529]

Details for d2aida_

PDB Entry: 2aid, 1.9 Å

PDB Description: structure of a non-peptide inhibitor complexed with hiv-1 protease: developing a cycle of structure-based drug design

SCOP Domain Sequences for d2aida_:

Sequence; same for both SEQRES and ATOM records:

>d2aida_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1}
pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
qipveicghkaigtvlvgptpvniigrnlltqigctlnf

Timeline for d2aida_:

• d2aida_ appears in SCOP 1.57
  
• d2aida_ appears in the current release, SCOPe 2.08