Lineage for d3r25c2 (3r25 C:118-401)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2445369Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2445529Family c.1.11.2: D-glucarate dehydratase-like [51609] (15 proteins)
  6. 2445723Protein automated matches [226997] (13 species)
    not a true protein
  7. 2445840Species Vibrionales bacterium [TaxId:391574] [267878] (2 PDB entries)
  8. 2445847Domain d3r25c2: 3r25 C:118-401 [265281]
    Other proteins in same PDB: d3r25a1, d3r25a3, d3r25b1, d3r25b3, d3r25c1, d3r25c3, d3r25d1, d3r25d3, d3r25e1, d3r25e3, d3r25f1, d3r25f3, d3r25g1, d3r25g3, d3r25h1, d3r25h3
    automated match to d3gy1a2
    complexed with gol, mg

Details for d3r25c2

PDB Entry: 3r25 (more details), 1.6 Å

PDB Description: Crystal structure of enolase superfamily member from Vibrionales bacterium complexed with Mg and Glycerol in the active site
PDB Compounds: (C:) Mandelate racemase / muconate lactonizing enzyme

SCOPe Domain Sequences for d3r25c2:

Sequence, based on SEQRES records: (download)

>d3r25c2 c.1.11.2 (C:118-401) automated matches {Vibrionales bacterium [TaxId: 391574]}
ksrdaipvythatsdtmegiydlvegflekgykhircqlgfyggvptdlhttqnptegsy
ydqdqymdntltmfkslrekygnqfhilhdvherlfpnqaiqfakeveqykpyfiedilp
pnqtewldnirsqssvslglgelfnnpeewkslianrridfirchvsqiggitpalklgh
lcqnfgvriawhcppdmtpigaavnthlnvhlhnaaiqehveyngnthkvfpnaaeping
ylyaseiagigveidreaaaefpvmyrphewtqsrlpdgaihtp

Sequence, based on observed residues (ATOM records): (download)

>d3r25c2 c.1.11.2 (C:118-401) automated matches {Vibrionales bacterium [TaxId: 391574]}
ksrdaipvythatsdtmegiydlvegflekgykhircqllhttqnptegsyydqdqymdn
tltmfkslrekygnqfhilhdvherlfpnqaiqfakeveqykpyfiedilppnqtewldn
irsqssvslglgelfnnpeewkslianrridfirchvsqiggitpalklghlcqnfgvri
awhcppdmtpigaavnthlnvhlhnaaiqehveyngnthkvfpnaaepingylyaseiag
igveidreaaaefpvmyrphewtqsrlpdgaihtp

SCOPe Domain Coordinates for d3r25c2:

Click to download the PDB-style file with coordinates for d3r25c2.
(The format of our PDB-style files is described here.)

Timeline for d3r25c2: