| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) ![]() binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
| Family c.1.11.2: D-glucarate dehydratase-like [51609] (15 proteins) |
| Protein automated matches [226997] (13 species) not a true protein |
| Species Vibrionales bacterium [TaxId:391574] [267878] (2 PDB entries) |
| Domain d3r25b2: 3r25 B:118-401 [265279] Other proteins in same PDB: d3r25a1, d3r25a3, d3r25b1, d3r25b3, d3r25c1, d3r25c3, d3r25d1, d3r25d3, d3r25e1, d3r25e3, d3r25f1, d3r25f3, d3r25g1, d3r25g3, d3r25h1, d3r25h3 automated match to d3gy1a2 complexed with gol, mg |
PDB Entry: 3r25 (more details), 1.6 Å
SCOPe Domain Sequences for d3r25b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3r25b2 c.1.11.2 (B:118-401) automated matches {Vibrionales bacterium [TaxId: 391574]}
ksrdaipvythatsdtmegiydlvegflekgykhircqlgfyggvptdlhttqnptegsy
ydqdqymdntltmfkslrekygnqfhilhdvherlfpnqaiqfakeveqykpyfiedilp
pnqtewldnirsqssvslglgelfnnpeewkslianrridfirchvsqiggitpalklgh
lcqnfgvriawhcppdmtpigaavnthlnvhlhnaaiqehveyngnthkvfpnaaeping
ylyaseiagigveidreaaaefpvmyrphewtqsrlpdgaihtp
Timeline for d3r25b2: