SCOPe 2.06: Domain d3r25a1: 3r25 A:4-117

Lineage for d3r25a1 (3r25 A:4-117)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (88 species)
   not a true protein

7. Species Vibrionales bacterium [TaxId:391574] [267877] (3 PDB entries)

8. Domain d3r25a1: 3r25 A:4-117 [265276]
   Other proteins in same PDB: d3r25a2, d3r25a3, d3r25b2, d3r25b3, d3r25c2, d3r25c3, d3r25d2, d3r25d3, d3r25e2, d3r25e3, d3r25f2, d3r25f3, d3r25g2, d3r25g3, d3r25h2, d3r25h3
   automated match to d3gy1a1
   complexed with gol, mg

Details for d3r25a1

PDB Entry: 3r25, 1.6 Å

PDB Description: Crystal structure of enolase superfamily member from Vibrionales bacterium complexed with Mg and Glycerol in the active site

PDB Compounds: (A:) Mandelate racemase / muconate lactonizing enzyme

SCOPe Domain Sequences for d3r25a1:

Sequence; same for both SEQRES and ATOM records:

>d3r25a1 d.54.1.0 (A:4-117) automated matches {Vibrionales bacterium [TaxId: 391574]}
ketiisdihciitkpdrhnlitvvvetnegvtgfgcatfqqrplavktmvdeylkpilig
knanniedlwqmmmvnaywrngpvinnaisgvdmalwdikaklagmplhqlfgg

Timeline for d3r25a1:

• d3r25a1 first appeared in SCOPe 2.05
  
• d3r25a1 appears in SCOPe 2.07
  
• d3r25a1 appears in the current release, SCOPe 2.08