![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
![]() | Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) ![]() |
![]() | Family c.66.1.0: automated matches [191451] (1 protein) not a true family |
![]() | Protein automated matches [190689] (87 species) not a true protein |
![]() | Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [267876] (1 PDB entry) |
![]() | Domain d3r0qe_: 3r0q E: [265274] automated match to d4qppa_ complexed with sah |
PDB Entry: 3r0q (more details), 2.61 Å
SCOPe Domain Sequences for d3r0qe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3r0qe_ c.66.1.0 (E:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} yfctysflyhqkdmlsdrvrmdayfnavfqnkhhfegktvldvgtgsgilaiwsaqagar kvyaveatkmadharalvkannldhiveviegsvedislpekvdviisewmgyfllresm fdsvisardrwlkptgvmypsharmwlapiksniadrkrndfdgamadwhnfsdeiksyy gvdmgvltkpfaeeqekyyiqtamwndlnpqqiigtptivkemdcltasvseieevrsnv tsvinmehtrlcgfggwfdvqfsgrkedpaqqeielttapseqhcthwgqqvfimsnpin veegdnlnlgllmsrskenhrlmeielnceikeasgnpkesfkktyfie
Timeline for d3r0qe_: