Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) |
Family c.66.1.0: automated matches [191451] (1 protein) not a true family |
Protein automated matches [190689] (64 species) not a true protein |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [267876] (1 PDB entry) |
Domain d3r0qc_: 3r0q C: [265273] automated match to d4qppa_ complexed with sah |
PDB Entry: 3r0q (more details), 2.61 Å
SCOPe Domain Sequences for d3r0qc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3r0qc_ c.66.1.0 (C:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} yfctysflyhqkdmlsdrvrmdayfnavfqnkhhfegktvldvgtgsgilaiwsaqagar kvyaveatkmadharalvkannldhiveviegsvedislpekvdviisewmgyfllresm fdsvisardrwlkptgvmypsharmwlapiksniadrkrndfdgamadwhnfsdeiksyy gvdmgvltkpfaeeqekyyiqtamwndlnpqqiigtptivkemdcltasvseieevrsnv tsvinmehtrlcgfggwfdvqfsgrkedpaqqeielttapseqhcthwgqqvfimsnpin veegdnlnlgllmsrskenhrlmeielnceikeasgnpkesfkktyfie
Timeline for d3r0qc_: