SCOPe 2.06: Domain d3r0qc_: 3r0q C:

Lineage for d3r0qc_ (3r0q C:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families)

5. Family c.66.1.0: automated matches [191451] (1 protein)
   not a true family

6. Protein automated matches [190689] (64 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [267876] (1 PDB entry)

8. Domain d3r0qc_: 3r0q C: [265273]
   automated match to d4qppa_
   complexed with sah

Details for d3r0qc_

PDB Entry: 3r0q, 2.61 Å

PDB Description: A Uniquely Open Conformation Revealed in the Crystal Structure of Arabidopsis Thaliana Protein Arginine Methyltransferase 10

PDB Compounds: (C:) Probable protein arginine N-methyltransferase 4.2

SCOPe Domain Sequences for d3r0qc_:

Sequence; same for both SEQRES and ATOM records:

>d3r0qc_ c.66.1.0 (C:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
yfctysflyhqkdmlsdrvrmdayfnavfqnkhhfegktvldvgtgsgilaiwsaqagar
kvyaveatkmadharalvkannldhiveviegsvedislpekvdviisewmgyfllresm
fdsvisardrwlkptgvmypsharmwlapiksniadrkrndfdgamadwhnfsdeiksyy
gvdmgvltkpfaeeqekyyiqtamwndlnpqqiigtptivkemdcltasvseieevrsnv
tsvinmehtrlcgfggwfdvqfsgrkedpaqqeielttapseqhcthwgqqvfimsnpin
veegdnlnlgllmsrskenhrlmeielnceikeasgnpkesfkktyfie

Timeline for d3r0qc_:

• d3r0qc_ first appeared in SCOPe 2.05
  
• d3r0qc_ appears in SCOPe 2.07
  
• d3r0qc_ appears in the current release, SCOPe 2.08