SCOPe 2.05: Domain d3qr3a_: 3qr3 A:

Lineage for d3qr3a_ (3qr3 A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.0: automated matches [191314] (1 protein)
   not a true family

6. Protein automated matches [190075] (72 species)
   not a true protein

7. Species Hypocrea jecorina [TaxId:51453] [267875] (1 PDB entry)

8. Domain d3qr3a_: 3qr3 A: [265268]
   automated match to d4lx4a_
   complexed with mg, so4

Details for d3qr3a_

PDB Entry: 3qr3, 2.05 Å

PDB Description: Crystal Structure of Cel5A (EG2) from Hypocrea jecorina (Trichoderma reesei)

PDB Compounds: (A:) Endoglucanase EG-II

SCOPe Domain Sequences for d3qr3a_:

Sequence; same for both SEQRES and ATOM records:

>d3qr3a_ c.1.8.0 (A:) automated matches {Hypocrea jecorina [TaxId: 51453]}
mgvrfagvniagfdfgcttdgtcvtskvypplknftgsnnypdgigqmqhfvnedgmtif
rlpvgwqylvnnnlggnldstsiskydqlvqgclslgaycivdihnyarwnggiigqggp
tnaqftslwsqlaskyasqsrvwfgimnephdvnintwaatvqevvtairnagatsqfis
lpgndwqsagafisdgsaaalsqvtnpdgsttnlifdvhkyldsdnsgthaecttnnidg
afsplatwlrqnnrqailtetgggnvqsciqdmcqqiqylnqnsdvylgyvgwgagsfds
tyvltetptssgnswtdtslvssclarkg

Timeline for d3qr3a_:

• d3qr3a_ is new in SCOPe 2.05-stable
  
• d3qr3a_ is called d3qr3a1 in SCOPe 2.06
  
• d3qr3a_ appears in the current release, SCOPe 2.08, called d3qr3a1