SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3qr3a1 (3qr3 A:1-327)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2083716Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2083717Protein automated matches [190075] (89 species)
    not a true protein
  7. 2083967Species Hypocrea jecorina [TaxId:51453] [267875] (1 PDB entry)
  8. 2083968Domain d3qr3a1: 3qr3 A:1-327 [265268]
    Other proteins in same PDB: d3qr3a2, d3qr3a3, d3qr3b2, d3qr3b3
    automated match to d4lx4a_
    complexed with mg, so4

Details for d3qr3a1

PDB Entry: 3qr3 (more details), 2.05 Å

PDB Description: Crystal Structure of Cel5A (EG2) from Hypocrea jecorina (Trichoderma reesei)
PDB Compounds: (A:) Endoglucanase EG-II

SCOPe Domain Sequences for d3qr3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qr3a1 c.1.8.0 (A:1-327) automated matches {Hypocrea jecorina [TaxId: 51453]}
gvrfagvniagfdfgcttdgtcvtskvypplknftgsnnypdgigqmqhfvnedgmtifr
lpvgwqylvnnnlggnldstsiskydqlvqgclslgaycivdihnyarwnggiigqggpt
naqftslwsqlaskyasqsrvwfgimnephdvnintwaatvqevvtairnagatsqfisl
pgndwqsagafisdgsaaalsqvtnpdgsttnlifdvhkyldsdnsgthaecttnnidga
fsplatwlrqnnrqailtetgggnvqsciqdmcqqiqylnqnsdvylgyvgwgagsfdst
yvltetptssgnswtdtslvssclark

SCOPe Domain Coordinates for d3qr3a1:

Click to download the PDB-style file with coordinates for d3qr3a1.
(The format of our PDB-style files is described here.)

Timeline for d3qr3a1:

  • d3qr3a1 first appeared in SCOPe 2.05, called d3qr3a_