| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) ![]() |
| Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
| Protein automated matches [226922] (95 species) not a true protein |
| Species Chromohalobacter salexigens [TaxId:158080] [267864] (6 PDB entries) |
| Domain d3qkeh1: 3qke H:4-113 [265266] Other proteins in same PDB: d3qkea2, d3qkea3, d3qkeb2, d3qkeb3, d3qkec2, d3qkec3, d3qked2, d3qked3, d3qkee2, d3qkee3, d3qkef2, d3qkef3, d3qkeg2, d3qkeg3, d3qkeh2, d3qkeh3 automated match to d4il2a1 complexed with gco, mg |
PDB Entry: 3qke (more details), 1.55 Å
SCOPe Domain Sequences for d3qkeh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qkeh1 d.54.1.0 (H:4-113) automated matches {Chromohalobacter salexigens [TaxId: 158080]}
kirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligrdag
riedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllgg
Timeline for d3qkeh1: