Lineage for d3qkeg1 (3qke G:3-113)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1904959Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 1904960Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 1905229Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 1905230Protein automated matches [226922] (83 species)
    not a true protein
  7. 1905386Species Chromohalobacter salexigens [TaxId:158080] [267864] (5 PDB entries)
  8. 1905393Domain d3qkeg1: 3qke G:3-113 [265264]
    Other proteins in same PDB: d3qkea2, d3qkeb2, d3qkec2, d3qked2, d3qkee2, d3qkef2, d3qkeg2, d3qkeh2
    automated match to d4il2a1
    complexed with gco, mg

Details for d3qkeg1

PDB Entry: 3qke (more details), 1.55 Å

PDB Description: Crystal structure of D-mannonate dehydratase from Chromohalobacter Salexigens complexed with Mg and D-Gluconate
PDB Compounds: (G:) Mandelate racemase/muconate lactonizing enzyme

SCOPe Domain Sequences for d3qkeg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qkeg1 d.54.1.0 (G:3-113) automated matches {Chromohalobacter salexigens [TaxId: 158080]}
lkirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligrda
griedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllgg

SCOPe Domain Coordinates for d3qkeg1:

Click to download the PDB-style file with coordinates for d3qkeg1.
(The format of our PDB-style files is described here.)

Timeline for d3qkeg1: