Lineage for d3qkec1 (3qke C:4-113)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947581Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2947582Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2947878Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2947879Protein automated matches [226922] (95 species)
    not a true protein
  7. 2948060Species Chromohalobacter salexigens [TaxId:158080] [267864] (6 PDB entries)
  8. 2948079Domain d3qkec1: 3qke C:4-113 [265256]
    Other proteins in same PDB: d3qkea2, d3qkea3, d3qkeb2, d3qkeb3, d3qkec2, d3qkec3, d3qked2, d3qked3, d3qkee2, d3qkee3, d3qkef2, d3qkef3, d3qkeg2, d3qkeg3, d3qkeh2, d3qkeh3
    automated match to d4il2a1
    complexed with gco, mg

Details for d3qkec1

PDB Entry: 3qke (more details), 1.55 Å

PDB Description: crystal structure of d-mannonate dehydratase from chromohalobacter salexigens complexed with mg and d-gluconate
PDB Compounds: (C:) Mandelate racemase/muconate lactonizing enzyme

SCOPe Domain Sequences for d3qkec1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qkec1 d.54.1.0 (C:4-113) automated matches {Chromohalobacter salexigens [TaxId: 158080]}
kirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligrdag
riedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllgg

SCOPe Domain Coordinates for d3qkec1:

Click to download the PDB-style file with coordinates for d3qkec1.
(The format of our PDB-style files is described here.)

Timeline for d3qkec1: