Lineage for d3qkaf_ (3qka F:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2852293Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2852294Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2853595Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2853596Protein automated matches [190246] (71 species)
    not a true protein
  7. 2853952Species Mycobacterium marinum [TaxId:216594] [189638] (4 PDB entries)
  8. 2853964Domain d3qkaf_: 3qka F: [265251]
    Other proteins in same PDB: d3qkac2, d3qkae2
    automated match to d4qfea_

Details for d3qkaf_

PDB Entry: 3qka (more details), 2.15 Å

PDB Description: crystal structure of enoyl-coa hydratase echa5 from mycobacterium marinum
PDB Compounds: (F:) Enoyl-CoA hydratase, EchA5

SCOPe Domain Sequences for d3qkaf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qkaf_ c.14.1.0 (F:) automated matches {Mycobacterium marinum [TaxId: 216594]}
dlvqverngpvttviinrpqarnavngptaaalysafaefdrdesasvavlcgnggtfca
gadlkafgtaeanavhrtgpgpmgpsrmmlskpviaavsgyavagglelalwcdlrvaeq
davfgvfcrrwgvplidggtvrlprlighsramdmiltgravqadealaiglanrvvpng
qarqaaeelaaqlaalpqqclrsdrlsalqqwglpesaaldlefasisrvaaealegag

SCOPe Domain Coordinates for d3qkaf_:

Click to download the PDB-style file with coordinates for d3qkaf_.
(The format of our PDB-style files is described here.)

Timeline for d3qkaf_: