Lineage for d3qkae1 (3qka E:2-241)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2099098Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2099099Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2100042Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2100043Protein automated matches [190246] (54 species)
    not a true protein
  7. 2100350Species Mycobacterium marinum [TaxId:216594] [189638] (4 PDB entries)
  8. 2100361Domain d3qkae1: 3qka E:2-241 [265250]
    Other proteins in same PDB: d3qkac2, d3qkae2
    automated match to d4qfea_

Details for d3qkae1

PDB Entry: 3qka (more details), 2.15 Å

PDB Description: crystal structure of enoyl-coa hydratase echa5 from mycobacterium marinum
PDB Compounds: (E:) Enoyl-CoA hydratase, EchA5

SCOPe Domain Sequences for d3qkae1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qkae1 c.14.1.0 (E:2-241) automated matches {Mycobacterium marinum [TaxId: 216594]}
sdlvqverngpvttviinrpqarnavngptaaalysafaefdrdesasvavlcgnggtfc
agadlkafgtaeanavhrtgpgpmgpsrmmlskpviaavsgyavagglelalwcdlrvae
qdavfgvfcrrwgvplidggtvrlprlighsramdmiltgravqadealaiglanrvvpn
gqarqaaeelaaqlaalpqqclrsdrlsalqqwglpesaaldlefasisrvaaealegag

SCOPe Domain Coordinates for d3qkae1:

Click to download the PDB-style file with coordinates for d3qkae1.
(The format of our PDB-style files is described here.)

Timeline for d3qkae1:

  • d3qkae1 first appeared in SCOPe 2.05, called d3qkae_