| Class a: All alpha proteins [46456] (286 folds) |
| Fold a.77: DEATH domain [47985] (1 superfamily) 6 helices: closed bundle; greek-key; internal pseudo twofold symmetry |
Superfamily a.77.1: DEATH domain [47986] (5 families) ![]() |
| Family a.77.1.0: automated matches [254238] (1 protein) not a true family |
| Protein automated matches [254542] (2 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [255408] (3 PDB entries) |
| Domain d3qf2a_: 3qf2 A: [265245] automated match to d2mpca_ |
PDB Entry: 3qf2 (more details), 1.7 Å
SCOPe Domain Sequences for d3qf2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qf2a_ a.77.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
strcklaryledledvdlkkfkmhledyppqkgciplprgqtekadhvdlatlmidfnge
ekawamavwifaainrrdlyekakrdepkw
Timeline for d3qf2a_: