SCOPe 2.07: Domain d3qf2a_: 3qf2 A:

Lineage for d3qf2a_ (3qf2 A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.77: DEATH domain [47985] (1 superfamily)
   6 helices: closed bundle; greek-key; internal pseudo twofold symmetry

4. Superfamily a.77.1: DEATH domain [47986] (5 families)

5. Family a.77.1.0: automated matches [254238] (1 protein)
   not a true family

6. Protein automated matches [254542] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255408] (4 PDB entries)

8. Domain d3qf2a_: 3qf2 A: [265245]
   automated match to d2mpca_

Details for d3qf2a_

PDB Entry: 3qf2, 1.7 Å

PDB Description: Crystal structure of NALP3 PYD

PDB Compounds: (A:) NACHT, LRR and PYD domains-containing protein 3

SCOPe Domain Sequences for d3qf2a_:

Sequence; same for both SEQRES and ATOM records:

>d3qf2a_ a.77.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
strcklaryledledvdlkkfkmhledyppqkgciplprgqtekadhvdlatlmidfnge
ekawamavwifaainrrdlyekakrdepkw

Timeline for d3qf2a_:

• d3qf2a_ first appeared in SCOPe 2.05
  
• d3qf2a_ appears in SCOPe 2.06