Lineage for d3pzma_ (3pzm A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2416558Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2418840Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2418841Protein automated matches [190075] (93 species)
    not a true protein
  7. 2419547Species Thermotoga petrophila [TaxId:390874] [267872] (6 PDB entries)
  8. 2419550Domain d3pzma_: 3pzm A: [265238]
    automated match to d3ziza_
    complexed with gol, trs

Details for d3pzma_

PDB Entry: 3pzm (more details), 1.5 Å

PDB Description: Structure of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 with three glycerol molecules
PDB Compounds: (A:) Mannan endo-1,4-beta-mannosidase. Glycosyl Hydrolase family 5

SCOPe Domain Sequences for d3pzma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pzma_ c.1.8.0 (A:) automated matches {Thermotoga petrophila [TaxId: 390874]}
frfigsnnyymhyksnrmidsvlesardmgikvlriwgfldgesycrdkntymhpepgvf
gvpegisnaqngferldytiakakelgikliivlvnnwddfggmnqyvrwfggthhddfy
rderikeeykkyvsflinhvnvytgvpyreeptimawelanelrcetdksgntlvewvke
mssyiksldpnhlvavgdegffsnyegfkpyggeaewayngwsgvdwkkllsietvdfgt
fhlypshwgvspenyaqwgakwiedhikiakeigkpvvleeygipksapvnrtaiyrlwn
dlvydlggdgamfwmlagigegsdrdergyypdydgfrivnddspeaelireyaklf

SCOPe Domain Coordinates for d3pzma_:

Click to download the PDB-style file with coordinates for d3pzma_.
(The format of our PDB-style files is described here.)

Timeline for d3pzma_: