Lineage for d3ptaa5 (3pta A:1135-1600)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2129999Family c.66.1.26: C5 cytosine-specific DNA methylase, DCM [88786] (5 protein domains)
    automatically mapped to Pfam PF00145
  6. 2130033Protein Methyltransferase domain from DNA methyltransferase 1 (DNMT1) [267659] (2 species)
  7. 2130034Species Human (Homo sapiens) [TaxId:9606] [267738] (1 PDB entry)
  8. 2130035Domain d3ptaa5: 3pta A:1135-1600 [265231]
    Other proteins in same PDB: d3ptaa1, d3ptaa2, d3ptaa3, d3ptaa4
    protein/DNA complex; complexed with sah, zn

Details for d3ptaa5

PDB Entry: 3pta (more details), 3.6 Å

PDB Description: Crystal structure of human DNMT1(646-1600) in complex with DNA
PDB Compounds: (A:) DNA (cytosine-5)-methyltransferase 1

SCOPe Domain Sequences for d3ptaa5:

Sequence, based on SEQRES records: (download)

>d3ptaa5 c.66.1.26 (A:1135-1600) Methyltransferase domain from DNA methyltransferase 1 (DNMT1) {Human (Homo sapiens) [TaxId: 9606]}
klpklrtldvfsgcgglsegfhqagisdtlwaiemwdpaaqafrlnnpgstvftedcnil
lklvmagettnsrgqrlpqkgdvemlcggppcqgfsgmnrfnsrtyskfknslvvsflsy
cdyyrprffllenvrnfvsfkrsmvlkltlrclvrmgyqctfgvlqagqygvaqtrrrai
ilaaapgeklplfpeplhvfapracqlsvvvddkkfvsnitrlssgpfrtitvrdtmsdl
pevrngasaleisyngepqswfqrqlrgaqyqpilrdhickdmsalvaarmrhiplapgs
dwrdlpnievrlsdgtmarklrythhdrkngrsssgalrgvcscveagkacdpaarqfnt
lipwclphtgnrhnhwaglygrlewdgffsttvtnpepmgkqgrvlhpeqhrvvsvreca
rsqgfpdtyrlfgnildkhrqvgnavppplakaigleiklcmlaka

Sequence, based on observed residues (ATOM records): (download)

>d3ptaa5 c.66.1.26 (A:1135-1600) Methyltransferase domain from DNA methyltransferase 1 (DNMT1) {Human (Homo sapiens) [TaxId: 9606]}
klpklrtldvfsgcgglsegfhqagisdtlwaiemwdpaaqafrlnnpgstvftedcnil
lklvmagettnsrgqrlpqkgdvemlcggppcqgfsgmnrfnsrtyskfknslvvsflsy
cdyyrprffllenvrnfvsfkrsmvlkltlrclvrmgyqctfgvlqagqygvaqtrrrai
ilaaapgeklplfpeplhvfapracqlsvvvddkkfvsnitrlssgpfrtitvrdtmsdl
pevrngasaleisyngepqswfqrqlrgaqyqpilrdhickdmsalvaarmrhiplapgs
dwrdlpnievrlsdgtmarklrythhdrkngrsssgalrgvcscvacdpaarqfntlipw
clphtgnrhnhwaglygrlewdgffsttvtnpepmgkqgrvlhpeqhrvvsvrecarsqg
fpdtyrlfgnildkhrqvgnavppplakaigleiklcmlaka

SCOPe Domain Coordinates for d3ptaa5:

Click to download the PDB-style file with coordinates for d3ptaa5.
(The format of our PDB-style files is described here.)

Timeline for d3ptaa5: