| Class g: Small proteins [56992] (100 folds) |
| Fold g.95: bi-CXXC zinc finger-like [267591] (1 superfamily) duplication; dimetal(zinc)-bound fold with little secondary structure |
Superfamily g.95.1: bi-CXXC zinc finger-like [267601] (1 family) ![]() Pfam PF02008; PubMed 21507349 suggests it is a duplication of the mono-CXXC domain, which is homologous to the Zn-finger subdomain of alcohol dehydrogenase (50137) |
| Family g.95.1.1: bi-CXXC zinc finger-like [267617] (3 proteins) |
| Protein Zn finger domain from DNA methyltransferase 1 (DNMT1) [267656] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [267732] (1 PDB entry) |
| Domain d3ptaa1: 3pta A:647-697 [265227] Other proteins in same PDB: d3ptaa2, d3ptaa3, d3ptaa4, d3ptaa5 protein/DNA complex; complexed with sah, zn |
PDB Entry: 3pta (more details), 3.6 Å
SCOPe Domain Sequences for d3ptaa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ptaa1 g.95.1.1 (A:647-697) Zn finger domain from DNA methyltransferase 1 (DNMT1) {Human (Homo sapiens) [TaxId: 9606]}
afkrrrcgvcevcqqpecgkckackdmvkfggsgrskqacqerrcpnmamk
Timeline for d3ptaa1:
View in 3DDomains from same chain: (mouse over for more information) d3ptaa2, d3ptaa3, d3ptaa4, d3ptaa5 |