Lineage for d3ptaa1 (3pta A:647-697)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3038986Fold g.95: bi-CXXC zinc finger-like [267591] (1 superfamily)
    duplication; dimetal(zinc)-bound fold with little secondary structure
  4. 3038987Superfamily g.95.1: bi-CXXC zinc finger-like [267601] (1 family) (S)
    Pfam PF02008; PubMed 21507349 suggests it is a duplication of the mono-CXXC domain, which is homologous to the Zn-finger subdomain of alcohol dehydrogenase (50137)
  5. 3038988Family g.95.1.1: bi-CXXC zinc finger-like [267617] (3 proteins)
  6. 3038989Protein Zn finger domain from DNA methyltransferase 1 (DNMT1) [267656] (2 species)
  7. 3038990Species Human (Homo sapiens) [TaxId:9606] [267732] (1 PDB entry)
  8. 3038991Domain d3ptaa1: 3pta A:647-697 [265227]
    Other proteins in same PDB: d3ptaa2, d3ptaa3, d3ptaa4, d3ptaa5
    protein/DNA complex; complexed with sah, zn

Details for d3ptaa1

PDB Entry: 3pta (more details), 3.6 Å

PDB Description: Crystal structure of human DNMT1(646-1600) in complex with DNA
PDB Compounds: (A:) DNA (cytosine-5)-methyltransferase 1

SCOPe Domain Sequences for d3ptaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ptaa1 g.95.1.1 (A:647-697) Zn finger domain from DNA methyltransferase 1 (DNMT1) {Human (Homo sapiens) [TaxId: 9606]}
afkrrrcgvcevcqqpecgkckackdmvkfggsgrskqacqerrcpnmamk

SCOPe Domain Coordinates for d3ptaa1:

Click to download the PDB-style file with coordinates for d3ptaa1.
(The format of our PDB-style files is described here.)

Timeline for d3ptaa1: