Lineage for d3pt9a2 (3pt9 A:912-1110)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2045654Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2047481Superfamily b.34.12: BAH domain [82061] (2 families) (S)
  5. 2047482Family b.34.12.1: BAH domain [82062] (2 protein domains)
  6. 2047483Protein BAH domains from DNA methyltransferase 1 (DNMT1) [267658] (2 species)
  7. 2047487Species Mouse (Mus musculus) [TaxId:10090] [267735] (4 PDB entries)
  8. 2047489Domain d3pt9a2: 3pt9 A:912-1110 [265225]
    Other proteins in same PDB: d3pt9a3, d3pt9a4
    automated match to d3ptaa4
    complexed with sah, zn

Details for d3pt9a2

PDB Entry: 3pt9 (more details), 2.5 Å

PDB Description: Crystal structure of mouse DNMT1(731-1602) in the free state
PDB Compounds: (A:) DNA (cytosine-5)-methyltransferase 1

SCOPe Domain Sequences for d3pt9a2:

Sequence, based on SEQRES records: (download)

>d3pt9a2 b.34.12.1 (A:912-1110) BAH domains from DNA methyltransferase 1 (DNMT1) {Mouse (Mus musculus) [TaxId: 10090]}
pkvleqieevdgrvycssitkngvvyrlgdsvylppeaftfnikvaspvkrpkkdpvnet
lypehyrkysdyikgsnldapepyrigrikeihcgkkkgkvneadiklrlykfyrpenth
rsyngsyhtdinmlywsdeeavvnfsdvqgrctveygedllesiqdysqggpdrfyflea
ynsktknfedppnharspg

Sequence, based on observed residues (ATOM records): (download)

>d3pt9a2 b.34.12.1 (A:912-1110) BAH domains from DNA methyltransferase 1 (DNMT1) {Mouse (Mus musculus) [TaxId: 10090]}
pkvleqieevdgrvycssitkngvvyrlgdsvylppeaftfnikvaspvkrpkkdpvnet
lypehyrkysldapepyrigrikeihcgkkkgkvneadiklrlykfyrpenthrsyngsy
htdinmlywsdeeavvnfsdvqgrctveygedllesiqdysqggpdrfyfleaynsktkn
fedppnharspg

SCOPe Domain Coordinates for d3pt9a2:

Click to download the PDB-style file with coordinates for d3pt9a2.
(The format of our PDB-style files is described here.)

Timeline for d3pt9a2: