Lineage for d3pt9a1 (3pt9 A:730-911)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1783288Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1785089Superfamily b.34.12: BAH domain [82061] (2 families) (S)
  5. 1785090Family b.34.12.1: BAH domain [82062] (2 proteins)
  6. 1785091Protein BAH domains from DNA methyltransferase 1 (DNMT1) [267658] (2 species)
  7. 1785095Species Mouse (Mus musculus) [TaxId:10090] [267735] (2 PDB entries)
  8. 1785096Domain d3pt9a1: 3pt9 A:730-911 [265224]
    Other proteins in same PDB: d3pt9a3
    automated match to d3ptaa3
    complexed with sah, zn

Details for d3pt9a1

PDB Entry: 3pt9 (more details), 2.5 Å

PDB Description: Crystal structure of mouse DNMT1(731-1602) in the free state
PDB Compounds: (A:) DNA (cytosine-5)-methyltransferase 1

SCOPe Domain Sequences for d3pt9a1:

Sequence, based on SEQRES records: (download)

>d3pt9a1 b.34.12.1 (A:730-911) BAH domains from DNA methyltransferase 1 (DNMT1) {Mouse (Mus musculus) [TaxId: 10090]}
skdriswlgqpmkieenrtyyqkvsideemlevgdcvsvipddsskplylarvtalwedk
ngqmmfhahwfcagtdtvlgatsdplelflvgecenmqlsyihskvkviykapsenwame
ggtdpettlpgaedgktyffqlwynqeyarfesppktqptednkhkfclscirlaelrqk
em

Sequence, based on observed residues (ATOM records): (download)

>d3pt9a1 b.34.12.1 (A:730-911) BAH domains from DNA methyltransferase 1 (DNMT1) {Mouse (Mus musculus) [TaxId: 10090]}
skdriswlgqpmkieenrtyyqkvsideemlevgdcvsvipddsskplylarvtalwedk
ngqmmfhahwfcagtdtvlgatsdplelflvgecenmqlsyihskvkviykapsenwame
gktyffqlwynqeyarfesppktqptednkhkfclscirlaelrqkem

SCOPe Domain Coordinates for d3pt9a1:

Click to download the PDB-style file with coordinates for d3pt9a1.
(The format of our PDB-style files is described here.)

Timeline for d3pt9a1: