Lineage for d3pt6b5 (3pt6 B:1138-1600)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2129999Family c.66.1.26: C5 cytosine-specific DNA methylase, DCM [88786] (5 protein domains)
    automatically mapped to Pfam PF00145
  6. 2130033Protein Methyltransferase domain from DNA methyltransferase 1 (DNMT1) [267659] (2 species)
  7. 2130036Species Mouse (Mus musculus) [TaxId:10090] [267737] (4 PDB entries)
  8. 2130039Domain d3pt6b5: 3pt6 B:1138-1600 [265223]
    Other proteins in same PDB: d3pt6a1, d3pt6a2, d3pt6a3, d3pt6a4, d3pt6b1, d3pt6b2, d3pt6b3, d3pt6b4
    protein/DNA complex; complexed with sah, zn

Details for d3pt6b5

PDB Entry: 3pt6 (more details), 3 Å

PDB Description: Crystal structure of mouse DNMT1(650-1602) in complex with DNA
PDB Compounds: (B:) DNA (cytosine-5)-methyltransferase 1

SCOPe Domain Sequences for d3pt6b5:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pt6b5 c.66.1.26 (B:1138-1600) Methyltransferase domain from DNA methyltransferase 1 (DNMT1) {Mouse (Mus musculus) [TaxId: 10090]}
klpklrtldvfsgcgglsegfhqagisetlwaiemwdpaaqafrlnnpgttvftedcnvl
lklvmagevtnslgqrlpqkgdvemlcggppcqgfsgmnrfnsrtyskfknslvvsflsy
cdyyrprffllenvrnfvsyrrsmvlkltlrclvrmgyqctfgvlqagqygvaqtrrrai
ilaaapgeklplfpeplhvfapracqlsvvvddkkfvsnitrlssgpfrtitvrdtmsdl
peiqngasnseipyngeplswfqrqlrgshyqpilrdhickdmsplvaarmrhiplfpgs
dwrdlpniqvrlgdgviahklqytfhdvkngysstgalrgvcscaegkacdpesrqfstl
ipwclphtgnrhnhwaglygrlewdgffsttvtnpepmgkqgrvlhpeqhrvvsvrecar
sqgfpdsyrffgnildrhrqvgnavppplakaigleiklclls

SCOPe Domain Coordinates for d3pt6b5:

Click to download the PDB-style file with coordinates for d3pt6b5.
(The format of our PDB-style files is described here.)

Timeline for d3pt6b5: