| Class b: All beta proteins [48724] (180 folds) |
| Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.12: BAH domain [82061] (2 families) ![]() |
| Family b.34.12.1: BAH domain [82062] (2 proteins) |
| Protein BAH domains from DNA methyltransferase 1 (DNMT1) [267658] (2 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [267735] (4 PDB entries) |
| Domain d3pt6b4: 3pt6 B:912-1112 [265222] Other proteins in same PDB: d3pt6a1, d3pt6a2, d3pt6a5, d3pt6b1, d3pt6b2, d3pt6b5 protein/DNA complex; complexed with sah, zn |
PDB Entry: 3pt6 (more details), 3 Å
SCOPe Domain Sequences for d3pt6b4:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pt6b4 b.34.12.1 (B:912-1112) BAH domains from DNA methyltransferase 1 (DNMT1) {Mouse (Mus musculus) [TaxId: 10090]}
pkvleqieevdgrvycssitkngvvyrlgdsvylppeaftfnikvaspvkrpkkdpvnet
lypehyrkysdyikgsnldapepyrigrikeihcgkkkgkvneadiklrlykfyrpenth
rsyngsyhtdinmlywsdeeavvnfsdvqgrctveygedllesiqdysqggpdrfyflea
ynsktknfedppnharspgnk
Timeline for d3pt6b4: