Lineage for d3pt6a4 (3pt6 A:912-1115)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1783288Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1785089Superfamily b.34.12: BAH domain [82061] (2 families) (S)
  5. 1785090Family b.34.12.1: BAH domain [82062] (2 proteins)
  6. 1785091Protein BAH domains from DNA methyltransferase 1 (DNMT1) [267658] (2 species)
  7. 1785095Species Mouse (Mus musculus) [TaxId:10090] [267735] (2 PDB entries)
  8. 1785099Domain d3pt6a4: 3pt6 A:912-1115 [265217]
    Other proteins in same PDB: d3pt6a1, d3pt6a2, d3pt6a5, d3pt6b1, d3pt6b2, d3pt6b5
    protein/DNA complex; complexed with sah, zn

Details for d3pt6a4

PDB Entry: 3pt6 (more details), 3 Å

PDB Description: Crystal structure of mouse DNMT1(650-1602) in complex with DNA
PDB Compounds: (A:) DNA (cytosine-5)-methyltransferase 1

SCOPe Domain Sequences for d3pt6a4:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pt6a4 b.34.12.1 (A:912-1115) BAH domains from DNA methyltransferase 1 (DNMT1) {Mouse (Mus musculus) [TaxId: 10090]}
pkvleqieevdgrvycssitkngvvyrlgdsvylppeaftfnikvaspvkrpkkdpvnet
lypehyrkysdyikgsnldapepyrigrikeihcgkkkgkvneadiklrlykfyrpenth
rsyngsyhtdinmlywsdeeavvnfsdvqgrctveygedllesiqdysqggpdrfyflea
ynsktknfedppnharspgnkgkg

SCOPe Domain Coordinates for d3pt6a4:

Click to download the PDB-style file with coordinates for d3pt6a4.
(The format of our PDB-style files is described here.)

Timeline for d3pt6a4: