Lineage for d3pt6a1 (3pt6 A:651-700)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3038986Fold g.95: bi-CXXC zinc finger-like [267591] (1 superfamily)
    duplication; dimetal(zinc)-bound fold with little secondary structure
  4. 3038987Superfamily g.95.1: bi-CXXC zinc finger-like [267601] (1 family) (S)
    Pfam PF02008; PubMed 21507349 suggests it is a duplication of the mono-CXXC domain, which is homologous to the Zn-finger subdomain of alcohol dehydrogenase (50137)
  5. 3038988Family g.95.1.1: bi-CXXC zinc finger-like [267617] (3 proteins)
  6. 3038989Protein Zn finger domain from DNA methyltransferase 1 (DNMT1) [267656] (2 species)
  7. 3038992Species Mouse (Mus musculus) [TaxId:10090] [267731] (1 PDB entry)
  8. 3038993Domain d3pt6a1: 3pt6 A:651-700 [265214]
    Other proteins in same PDB: d3pt6a2, d3pt6a3, d3pt6a4, d3pt6a5, d3pt6b2, d3pt6b3, d3pt6b4, d3pt6b5
    protein/DNA complex; complexed with sah, zn

Details for d3pt6a1

PDB Entry: 3pt6 (more details), 3 Å

PDB Description: Crystal structure of mouse DNMT1(650-1602) in complex with DNA
PDB Compounds: (A:) DNA (cytosine-5)-methyltransferase 1

SCOPe Domain Sequences for d3pt6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pt6a1 g.95.1.1 (A:651-700) Zn finger domain from DNA methyltransferase 1 (DNMT1) {Mouse (Mus musculus) [TaxId: 10090]}
mkrrrcgvcevcqqpecgkckackdmvkfggtgrskqaclkrrcpnlavk

SCOPe Domain Coordinates for d3pt6a1:

Click to download the PDB-style file with coordinates for d3pt6a1.
(The format of our PDB-style files is described here.)

Timeline for d3pt6a1: