![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.95: bi-CXXC zinc finger-like [267591] (1 superfamily) duplication; dimetal(zinc)-bound fold with little secondary structure |
![]() | Superfamily g.95.1: bi-CXXC zinc finger-like [267601] (1 family) ![]() Pfam PF02008; PubMed 21507349 suggests it is a duplication of the mono-CXXC domain, which is homologous to the Zn-finger subdomain of alcohol dehydrogenase (50137) |
![]() | Family g.95.1.1: bi-CXXC zinc finger-like [267617] (3 proteins) |
![]() | Protein Zn finger domain from DNA methyltransferase 1 (DNMT1) [267656] (2 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [267731] (1 PDB entry) |
![]() | Domain d3pt6a1: 3pt6 A:651-700 [265214] Other proteins in same PDB: d3pt6a2, d3pt6a3, d3pt6a4, d3pt6a5, d3pt6b2, d3pt6b3, d3pt6b4, d3pt6b5 protein/DNA complex; complexed with sah, zn |
PDB Entry: 3pt6 (more details), 3 Å
SCOPe Domain Sequences for d3pt6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pt6a1 g.95.1.1 (A:651-700) Zn finger domain from DNA methyltransferase 1 (DNMT1) {Mouse (Mus musculus) [TaxId: 10090]} mkrrrcgvcevcqqpecgkckackdmvkfggtgrskqaclkrrcpnlavk
Timeline for d3pt6a1: