![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
![]() | Protein automated matches [190154] (92 species) not a true protein |
![]() | Species Xylella fastidiosa [TaxId:2371] [267870] (2 PDB entries) |
![]() | Domain d3pqke_: 3pqk E: [265212] automated match to d4k2ea_ |
PDB Entry: 3pqk (more details), 2.09 Å
SCOPe Domain Sequences for d3pqke_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pqke_ a.4.5.0 (E:) automated matches {Xylella fastidiosa [TaxId: 2371]} tredmekranevanllktlshpvrlmlvctlvegefsvgeleqqigigqptlsqqlgvlr esgivetrrnikqifyrlteakaaqlvnalytifcaqekqa
Timeline for d3pqke_: