Lineage for d3pqjb_ (3pqj B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2694554Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2694555Protein automated matches [190154] (92 species)
    not a true protein
  7. 2695219Species Xylella fastidiosa [TaxId:2371] [267870] (2 PDB entries)
  8. 2695227Domain d3pqjb_: 3pqj B: [265205]
    automated match to d4k2ea_

Details for d3pqjb_

PDB Entry: 3pqj (more details), 2.48 Å

PDB Description: Crystal Structure of the transcriptional repressor BigR from Xylella fastidiosa
PDB Compounds: (B:) Biofilm growth-associated repressor

SCOPe Domain Sequences for d3pqjb_:

Sequence, based on SEQRES records: (download)

>d3pqjb_ a.4.5.0 (B:) automated matches {Xylella fastidiosa [TaxId: 2371]}
mtredmekranevanllktlshpvrlmlvctlvegefsvgeleqqigigqptlsqqlgvl
resgivetrrnikqifyrlteakaaqlvnalytifca

Sequence, based on observed residues (ATOM records): (download)

>d3pqjb_ a.4.5.0 (B:) automated matches {Xylella fastidiosa [TaxId: 2371]}
mtredmekranevanllktlshpvrlmlvctlvegefsvgeleqqigiqqlgvlresgiv
etrrnikqifyrlteakaaqlvnalytifca

SCOPe Domain Coordinates for d3pqjb_:

Click to download the PDB-style file with coordinates for d3pqjb_.
(The format of our PDB-style files is described here.)

Timeline for d3pqjb_: