Lineage for d3ppha2 (3pph A:404-766)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2089841Superfamily c.1.22: UROD/MetE-like [51726] (3 families) (S)
  5. 2089888Family c.1.22.0: automated matches [191464] (1 protein)
    not a true family
  6. 2089889Protein automated matches [190717] (5 species)
    not a true protein
  7. 2089916Species Yeast (Candida albicans) [TaxId:5476] [267869] (5 PDB entries)
  8. 2089926Domain d3ppha2: 3pph A:404-766 [265203]
    automated match to d1u1ja2

Details for d3ppha2

PDB Entry: 3pph (more details), 2.8 Å

PDB Description: Crystal structure of the Candida albicans methionine synthase by surface entropy reduction, threonine variant
PDB Compounds: (A:) 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase

SCOPe Domain Sequences for d3ppha2:

Sequence, based on SEQRES records: (download)

>d3ppha2 c.1.22.0 (A:404-766) automated matches {Yeast (Candida albicans) [TaxId: 5476]}
dpkvqerlttinealatrkaafperlteqkakynlplfptttigsfpqtkdirinrnkfa
kgqitaeeyeafinkeietvvrfqeeigldvlvhgeperndmvqyfgeqlngfafttngw
vqsygsryvrppiivgdvsrpkamtvkesvyaqsitskpmkgmltgpvtilrwsfprddv
sgkiqalqlglalrdevndlegagitviqvdepaireglplragkersdylnwaaqsfrv
atsgvenstqihshfcysdldpnhikaldadvvsiefskkddpnyiqefseypnhiglgl
fdihspripskqefvsrieeilkvypaskfwvnpdcglktrgwpevkesltnmveaakef
rak

Sequence, based on observed residues (ATOM records): (download)

>d3ppha2 c.1.22.0 (A:404-766) automated matches {Yeast (Candida albicans) [TaxId: 5476]}
dpkvqerlttinealatrkaafperlteqkakynlplfptttigsfpqtkdirinrnkfa
kgqitaeeyeafinkeietvvrfqeeigldvlvhgeperndmvqyfgeqlngfafttngw
vqsygsryvrppiivgdvsrpkamtvkesvyaqsitskpmkgmltgpvtilrwsfprddv
sgkiqalqlglalrdevndlegagitviqvdepaireglplragkersdylnwaaqsfrv
atsgvenstqihshfcyldpnhikaldadvvsiefskkddpnyiqefseypnhiglglfs
kqefvsrieeilkvypaskfwvnpdcglktrgwpevkesltnmveaakefrak

SCOPe Domain Coordinates for d3ppha2:

Click to download the PDB-style file with coordinates for d3ppha2.
(The format of our PDB-style files is described here.)

Timeline for d3ppha2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ppha1