Lineage for d3po5a2 (3po5 A:423-832)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2571153Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 2571154Superfamily e.8.1: DNA/RNA polymerases [56672] (8 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 2571155Family e.8.1.1: DNA polymerase I [56673] (5 proteins)
  6. 2571448Protein automated matches [226972] (9 species)
    not a true protein
  7. 2571499Species Thermus aquaticus [TaxId:271] [267868] (4 PDB entries)
  8. 2571503Domain d3po5a2: 3po5 A:423-832 [265201]
    Other proteins in same PDB: d3po5a1
    automated match to d3rrha2
    protein/DNA complex; complexed with dds, gol, mg, pge; mutant

Details for d3po5a2

PDB Entry: 3po5 (more details), 2.39 Å

PDB Description: structure of a mutant of the large fragment of dna polymerase i from thermus auqaticus in complex with an abasic site and ddatp
PDB Compounds: (A:) DNA polymerase I

SCOPe Domain Sequences for d3po5a2:

Sequence, based on SEQRES records: (download)

>d3po5a2 e.8.1.1 (A:423-832) automated matches {Thermus aquaticus [TaxId: 271]}
eerllwlyreverplsavlahmeatgvrldvaylralslevaeeiarleaevfrlaghpf
nlnsrdqlervlfdelglpaigktektgkrstsaavlealreahpivekilqyreltklk
styidplpdlihprtgrlhtrfnqtatatgrlsssdpnlqnipvrtplgqrirrafiaee
gwllvaldysqkelrvlahlsgdenlirvfqegrdihtetaswmfgvpreavdplmrraa
ktinfgvlygmsahrlsqelaipyeeaqafieryfqsfpkvrawiektleegrrrgyvet
lfgrrryvpdlearvksvreaaerkafnmpvqgtaadlmklamvklfprleemgarmllq
vhdelvleapkeraeavarlakevmegvyplavplevevgigedwlsake

Sequence, based on observed residues (ATOM records): (download)

>d3po5a2 e.8.1.1 (A:423-832) automated matches {Thermus aquaticus [TaxId: 271]}
eerllwlyreverplsavlahmeatgvrldvaylralslevaeeiarleaevfrlaghpf
nlnsrdqlervlfdelglpaigktektgkrstsaavlealreahpivekilqyreltklk
styidplpdlihprtgrlhtrfnqtatatgrlsssdpnlqnipvrtplgqrirrafiaee
gwllvaldysqkelrvlahlsgdenlirvfqegrdihtetaswplmrraaktinfgvlyg
msahrlsqelaipyeeaqafieryfqsfpkvrawiektleegrrrgyvetlfgrrryvpd
learvksvreaaerkafnmpvqgtaadlmklamvklfprleemgarmllqvhdelvleap
keraeavarlakevmegvyplavplevevgigedwlsake

SCOPe Domain Coordinates for d3po5a2:

Click to download the PDB-style file with coordinates for d3po5a2.
(The format of our PDB-style files is described here.)

Timeline for d3po5a2: