SCOPe 2.06: Domain d3po4a2: 3po4 A:423-832

Lineage for d3po4a2 (3po4 A:423-832)

1. Root: SCOPe 2.06

2. Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)

3. Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
   divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members

4. Superfamily e.8.1: DNA/RNA polymerases [56672] (7 families)
   "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain

5. Family e.8.1.1: DNA polymerase I [56673] (5 proteins)

6. Protein automated matches [226972] (9 species)
   not a true protein

7. Species Thermus aquaticus [TaxId:271] [267868] (4 PDB entries)

8. Domain d3po4a2: 3po4 A:423-832 [265199]
   Other proteins in same PDB: d3po4a1
   automated match to d3rrha2
   protein/DNA complex; complexed with dds, gol, mg, na; mutant

Details for d3po4a2

PDB Entry: 3po4, 1.8 Å

PDB Description: structure of a mutant of the large fragment of dna polymerase i from thermus aquaticus in complex with a blunt-ended dna and ddatp

PDB Compounds: (A:) DNA polymerase I

SCOPe Domain Sequences for d3po4a2:

Sequence; same for both SEQRES and ATOM records:

>d3po4a2 e.8.1.1 (A:423-832) automated matches {Thermus aquaticus [TaxId: 271]}
eerllwlyreverplsavlahmeatgvrldvaylralslevaeeiarleaevfrlaghpf
nlnsrdqlervlfdelglpaigktektgkrstsaavlealreahpivekilqyreltklk
styidplpdlihprtgrlhtrfnqtatatgrlsssdpnlqnipvrtplgqrirrafiaee
gwllvaldysqkelrvlahlsgdenlirvfqegrdihtetaswmfgvpreavdplmrraa
ktinfgvlygmsahrlsqelaipyeeaqafieryfqsfpkvrawiektleegrrrgyvet
lfgrrryvpdlearvksvreaaerkafnmpvqgtaadlmklamvklfprleemgarmllq
vhdelvleapkeraeavarlakevmegvyplavplevevgigedwlsake

Timeline for d3po4a2:

• d3po4a2 first appeared in SCOPe 2.05
  
• d3po4a2 appears in SCOPe 2.07
  
• d3po4a2 appears in the current release, SCOPe 2.08