Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (16 families) consists of one domain of this fold |
Family c.55.3.0: automated matches [191357] (1 protein) not a true family |
Protein automated matches [190396] (40 species) not a true protein |
Species Thermus aquaticus [TaxId:271] [267867] (4 PDB entries) |
Domain d3po4a1: 3po4 A:295-422 [265198] Other proteins in same PDB: d3po4a2 automated match to d1bgxt3 protein/DNA complex; complexed with dds, gol, mg, na; mutant |
PDB Entry: 3po4 (more details), 1.8 Å
SCOPe Domain Sequences for d3po4a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3po4a1 c.55.3.0 (A:295-422) automated matches {Thermus aquaticus [TaxId: 271]} eeapwpppegafvgfvlsrkepmwadllalaaarggrvhrapepykalrdlkeargllak dlsvlalreglglppgddpmllaylldpsnttpegvarryggewteeageraalserlfa nlwgrleg
Timeline for d3po4a1: