Lineage for d3po4a1 (3po4 A:295-422)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2491249Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2493668Superfamily c.55.3: Ribonuclease H-like [53098] (16 families) (S)
    consists of one domain of this fold
  5. 2495032Family c.55.3.0: automated matches [191357] (1 protein)
    not a true family
  6. 2495033Protein automated matches [190396] (40 species)
    not a true protein
  7. 2495336Species Thermus aquaticus [TaxId:271] [267867] (4 PDB entries)
  8. 2495339Domain d3po4a1: 3po4 A:295-422 [265198]
    Other proteins in same PDB: d3po4a2
    automated match to d1bgxt3
    protein/DNA complex; complexed with dds, gol, mg, na; mutant

Details for d3po4a1

PDB Entry: 3po4 (more details), 1.8 Å

PDB Description: structure of a mutant of the large fragment of dna polymerase i from thermus aquaticus in complex with a blunt-ended dna and ddatp
PDB Compounds: (A:) DNA polymerase I

SCOPe Domain Sequences for d3po4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3po4a1 c.55.3.0 (A:295-422) automated matches {Thermus aquaticus [TaxId: 271]}
eeapwpppegafvgfvlsrkepmwadllalaaarggrvhrapepykalrdlkeargllak
dlsvlalreglglppgddpmllaylldpsnttpegvarryggewteeageraalserlfa
nlwgrleg

SCOPe Domain Coordinates for d3po4a1:

Click to download the PDB-style file with coordinates for d3po4a1.
(The format of our PDB-style files is described here.)

Timeline for d3po4a1: