SCOPe 2.05: Domain d3po4a1: 3po4 A:295-422

Lineage for d3po4a1 (3po4 A:295-422)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (15 families)
   consists of one domain of this fold

5. Family c.55.3.0: automated matches [191357] (1 protein)
   not a true family

6. Protein automated matches [190396] (30 species)
   not a true protein

7. Species Thermus aquaticus [TaxId:271] [267867] (4 PDB entries)

8. Domain d3po4a1: 3po4 A:295-422 [265198]
   Other proteins in same PDB: d3po4a2
   automated match to d1bgxt3
   protein/DNA complex; complexed with dds, gol, mg, na; mutant

Details for d3po4a1

PDB Entry: 3po4, 1.8 Å

PDB Description: structure of a mutant of the large fragment of dna polymerase i from thermus aquaticus in complex with a blunt-ended dna and ddatp

PDB Compounds: (A:) DNA polymerase I

SCOPe Domain Sequences for d3po4a1:

Sequence; same for both SEQRES and ATOM records:

>d3po4a1 c.55.3.0 (A:295-422) automated matches {Thermus aquaticus [TaxId: 271]}
eeapwpppegafvgfvlsrkepmwadllalaaarggrvhrapepykalrdlkeargllak
dlsvlalreglglppgddpmllaylldpsnttpegvarryggewteeageraalserlfa
nlwgrleg

Timeline for d3po4a1:

• d3po4a1 is new in SCOPe 2.05-stable
  
• d3po4a1 appears in SCOPe 2.06
  
• d3po4a1 appears in the current release, SCOPe 2.08