![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
![]() | Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) ![]() |
![]() | Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
![]() | Protein automated matches [226922] (95 species) not a true protein |
![]() | Species Chromohalobacter salexigens [TaxId:158080] [267864] (6 PDB entries) |
![]() | Domain d3pk7h1: 3pk7 H:4-113 [265196] Other proteins in same PDB: d3pk7a2, d3pk7a3, d3pk7b2, d3pk7b3, d3pk7c2, d3pk7c3, d3pk7d2, d3pk7d3, d3pk7e2, d3pk7e3, d3pk7f2, d3pk7f3, d3pk7g2, d3pk7g3, d3pk7h2, d3pk7h3 automated match to d4il2a1 complexed with gol, mg |
PDB Entry: 3pk7 (more details), 1.64 Å
SCOPe Domain Sequences for d3pk7h1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pk7h1 d.54.1.0 (H:4-113) automated matches {Chromohalobacter salexigens [TaxId: 158080]} kirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligrdag riedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllgg
Timeline for d3pk7h1: