Lineage for d3pk7g1 (3pk7 G:4-113)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947581Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2947582Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2947878Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2947879Protein automated matches [226922] (95 species)
    not a true protein
  7. 2948060Species Chromohalobacter salexigens [TaxId:158080] [267864] (6 PDB entries)
  8. 2948067Domain d3pk7g1: 3pk7 G:4-113 [265194]
    Other proteins in same PDB: d3pk7a2, d3pk7a3, d3pk7b2, d3pk7b3, d3pk7c2, d3pk7c3, d3pk7d2, d3pk7d3, d3pk7e2, d3pk7e3, d3pk7f2, d3pk7f3, d3pk7g2, d3pk7g3, d3pk7h2, d3pk7h3
    automated match to d4il2a1
    complexed with gol, mg

Details for d3pk7g1

PDB Entry: 3pk7 (more details), 1.64 Å

PDB Description: Crystal structure of D-mannonate dehydratase from Chromohalobacter salexigens with MG and Glycerol bound in the active site
PDB Compounds: (G:) Mandelate racemase/muconate lactonizing enzyme

SCOPe Domain Sequences for d3pk7g1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pk7g1 d.54.1.0 (G:4-113) automated matches {Chromohalobacter salexigens [TaxId: 158080]}
kirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligrdag
riedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllgg

SCOPe Domain Coordinates for d3pk7g1:

Click to download the PDB-style file with coordinates for d3pk7g1.
(The format of our PDB-style files is described here.)

Timeline for d3pk7g1: