SCOPe 2.08: Domain d3pk7f1: 3pk7 F:4-113

Lineage for d3pk7f1 (3pk7 F:4-113)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (95 species)
   not a true protein

7. Species Chromohalobacter salexigens [TaxId:158080] [267864] (6 PDB entries)

8. Domain d3pk7f1: 3pk7 F:4-113 [265192]
   Other proteins in same PDB: d3pk7a2, d3pk7a3, d3pk7b2, d3pk7b3, d3pk7c2, d3pk7c3, d3pk7d2, d3pk7d3, d3pk7e2, d3pk7e3, d3pk7f2, d3pk7f3, d3pk7g2, d3pk7g3, d3pk7h2, d3pk7h3
   automated match to d4il2a1
   complexed with gol, mg

Details for d3pk7f1

PDB Entry: 3pk7, 1.64 Å

PDB Description: Crystal structure of D-mannonate dehydratase from Chromohalobacter salexigens with MG and Glycerol bound in the active site

PDB Compounds: (F:) Mandelate racemase/muconate lactonizing enzyme

SCOPe Domain Sequences for d3pk7f1:

Sequence; same for both SEQRES and ATOM records:

>d3pk7f1 d.54.1.0 (F:4-113) automated matches {Chromohalobacter salexigens [TaxId: 158080]}
kirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligrdag
riedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllgg

Timeline for d3pk7f1:

• d3pk7f1 first appeared in SCOPe 2.05
  
• d3pk7f1 appears in SCOPe 2.07