SCOP 1.63: Domain d1bwbb_: 1bwb B:

Lineage for d1bwbb_ (1bwb B:)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (2 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (8 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein Human immunodeficiency virus type 1 protease [50632] (1 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (151 PDB entries)

8. Domain d1bwbb_: 1bwb B: [26518]
   complexed with sd1; mutant

Details for d1bwbb_

PDB Entry: 1bwb, 1.8 Å

PDB Description: hiv-1 protease (v82f/i84v) double mutant complexed with sd146 of dupont pharmaceuticals

SCOP Domain Sequences for d1bwbb_:

Sequence; same for both SEQRES and ATOM records:

>d1bwbb_ b.50.1.1 (B:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1}
pqvtlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
qilieicghkaigtvlvgptpfnvigrnlltqigctlnf

Timeline for d1bwbb_:

• d1bwbb_ first appeared (with stable ids) in SCOP 1.55
  
• d1bwbb_ appears in SCOP 1.61
  
• d1bwbb_ appears in SCOP 1.65
  
• d1bwbb_ appears in the current release, SCOPe 2.08