![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
![]() | Protein automated matches [190123] (96 species) not a true protein |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [225477] (11 PDB entries) |
![]() | Domain d3peya1: 3pey A:91-286 [265179] automated match to d3rrma1 protein/RNA complex; complexed with adp, bef, gol, mg, no3 |
PDB Entry: 3pey (more details), 1.4 Å
SCOPe Domain Sequences for d3peya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3peya1 c.37.1.0 (A:91-286) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} aksfdelglapellkgiyamkfqkpskiqeralplllhnpprnmiaqsqsgtgktaafsl tmltrvnpedaspqaiclapsrelarqtlevvqemgkftkitsqlivpdsfeknkqinaq vivgtpgtvldlmrrklmqlqkikifvldeadnmldqqglgdqcirvkrflpkdtqlvlf satfadavrqyakkiv
Timeline for d3peya1: